SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9K914 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9K914
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-79
Family Protein kinases, catalytic subunit 0.00000000143
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 6.55e-38
Family SH2 domain 0.0000097
Further Details:      
 
Domain Number 3 Region: 64-149
Classification Level Classification E-value
Superfamily SH3-domain 8.95e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9K914
Sequence length 512
Comment (tr|G9K914|G9K914_MUSPF) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LYN OC=Mustelinae; Mustela.
Sequence
MGCIKSKRKDNLNDDGIDLKTQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVIALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNGPGAFLIRESETLKGSYSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRDSIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences G9K914
ENSMPUP00000010388 ENSMPUP00000010388 XP_004768860.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]