SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9KG26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9KG26
Domain Number 1 Region: 265-340
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000459
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9KG26
Sequence length 403
Comment (tr|G9KG26|G9KG26_MUSPF) Peroxisomal bioproteinis factor 13 {ECO:0000313|EMBL:AES03851.1} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLLTRPGQPTLTRVPPPILPRPS
QQTGSSNVNTFRPAYSSFSSGYGAYGNSFYGSYSPYSYGYNGLGYNRLRVDDLPPSRFVQ
QAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFS
AFALVRTIRYLYRRLQWMIGLRRGSENEDLWAESEGTVACLGTEDRAANSAKSWPIFLFF
AVILGGPYLIWKLLSTHNDEITDNTNWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLN
LALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKAVESSKISKQQQPFNNTTL
TKGATAADSLDEQEAAFESVFVETNKVPVALDSTGKGGDKQDL
Download sequence
Identical sequences G9KG26
ENSMPUP00000005190 ENSMPUP00000005190 XP_004742077.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]