SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9KY56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9KY56
Domain Number 1 Region: 119-159
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G9KY56
Sequence length 400
Comment (tr|G9KY56|G9KY56_MUSPF) WW domain containing transcription regulator 1 {ECO:0000313|EMBL:AES09835.1, ECO:0000313|Ensembl:ENSMPUP00000002491} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=WWTR1 OC=Mustelinae; Mustela.
Sequence
MNPASVPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLASGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNPMNLHSAATSTPAPQR
SMAVSQPNLVMNHQHQQQMAPTPLSQQNHPPQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLATVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGDNTGQTAMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL
Download sequence
Identical sequences G9KY56
ENSMPUP00000002491 XP_004755577.1.14098 ENSMPUP00000002491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]