SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G9MHW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G9MHW3
Domain Number 1 Region: 42-129
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000445
Family HMG-box 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G9MHW3
Sequence length 202
Comment (tr|G9MHW3|G9MHW3_HYPVG) Uncharacterized protein {ECO:0000313|EMBL:EHK26300.1} KW=Complete proteome; Reference proteome OX=413071 OS=(Trichoderma virens). GN=TRIVIDRAFT_35357 OC=Trichoderma.
Sequence
MSPQISLPLLGEGTAEGPQGDLLNTFDATGQLIMPMPGITPIVEEKKERKKRTYDPNAPK
RPLTAFFLYMQHARSIIAIDLGADAPKGAIQVEGELRWAYMDPREKLGWSSAYQFNLRLY
NARVHSYKNRNFDAKNMPDGEAFMYAKDFHIPMPELKEIATQAKVPVNDKETIVELLQQV
TAAACDGDEEEIMNSVYDIALG
Download sequence
Identical sequences G9MHW3
jgi|Trive1|35357|e_gw1.5.1269.1 XP_013960512.1.71794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]