SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0EMJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0EMJ6
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.31e-23
Family PHBH-like 0.00067
Further Details:      
 
Domain Number 2 Region: 187-291
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.35e-23
Family Glutathione peroxidase-like 0.0011
Further Details:      
 
Domain Number 3 Region: 79-166
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.28e-18
Family FAD-linked reductases, N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0EMJ6
Sequence length 311
Comment (tr|H0EMJ6|H0EMJ6_GLAL7) Putative Phenol 2-monooxygenase {ECO:0000313|EMBL:EHL00336.1} KW=Complete proteome; Reference proteome OX=1104152 OS=Glarea lozoyensis (strain ATCC 74030 / MF5533). GN=M7I_3833 OC=Helotiales; Helotiaceae; Glarea.
Sequence
MDTYPLTNFPDIRKKSVIHSAHGVLMIIPREGGSLARFYIELHSSTVPKSVTLAQLQESA
RKIFNPYELEFADTYWWSAYSIGQRLAERFHEQERVFLAGDACHTHSPKAGQGMNTSLQD
GYNIGWKLGQLLSGRASASLLSTYLLERQKIAKTLIDFDRVWAKQIAAGKSVGDDGKEVD
FSETFNNAEKLERLGEYLYSTPISLISKFTKPEEDIDSFIETIVILSGNRTETQQDQIPP
CFMPVSGKYRMRDIHKIYIDDESYNYGHGHAYEFYGIDPDKGAIVIVRPDHLDVKIDGGA
KGFKFNMILRE
Download sequence
Identical sequences H0EMJ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]