SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0GJ17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0GJ17
Domain Number - Region: 98-162
Classification Level Classification E-value
Superfamily TPR-like 0.00136
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0GJ17
Sequence length 463
Comment (tr|H0GJ17|H0GJ17_SACCK) YKL133C-like protein {ECO:0000313|EMBL:EHN06070.1} KW=Complete proteome OX=1095631 OS=(Yeast). GN=VIN7_2886 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI
VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENV
DLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD
LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK
GLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGA
LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELI
RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL
HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI
Download sequence
Identical sequences B3LQW7 C7GVI3 H0GJ17 N1P8C6 P36066
NP_012789.2.97178 YKL133C YKL133C SCRT_03893 YKL133C YKL133C YKL133C YKL133C YKL133C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]