SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0UUG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0UUG7
Domain Number 1 Region: 520-889
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-127
Family Hect, E3 ligase catalytic domain 0.00000000423
Further Details:      
 
Domain Number 2 Region: 17-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-29
Family PLC-like (P variant) 0.093
Further Details:      
 
Domain Number 3 Region: 465-505
Classification Level Classification E-value
Superfamily WW domain 0.000000000000032
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 339-379
Classification Level Classification E-value
Superfamily WW domain 0.000000000000153
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 186-222
Classification Level Classification E-value
Superfamily WW domain 0.000000000000946
Family WW domain 0.0012
Further Details:      
 
Domain Number 6 Region: 417-451
Classification Level Classification E-value
Superfamily WW domain 0.00000000000138
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0UUG7
Sequence length 896
Comment (tr|H0UUG7|H0UUG7_CAVPO) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=NEDD4 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MDLGAAAFLGLPEDEENSRIVRVKVIAGIGLAKKDILGSSDPYVRVTLYDPMNGVFTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRL
ERPYTFKDFVLHPKSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDA
ASHLQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDDLTDAEGGDIQLQAQR
AFTTRRQISEETESSDIQESENWEIIREDETAVSSSQTFPPPPPPGLLDVQPHLAEELSA
RLTVHQNSSASQPAASSNHASSRGSLQAYTYEEQPALPVLLPTSSGLPPGWEEKQDERGR
VYYVDHNSRTTTWTKPTVQATLEASPAPSGQGSSAGLPATERDTRQPPAQPPEIQHGLLP
KGWEVRHAPNGRPFYIDHNTKTTTWEDPRLKIPAHLRGKAPPEYSGDLGPLPPGWEERTH
TDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFE
MKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPY
YGLFEYSATDNYTLQINANSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMM
LHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVV
TNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKLFDENELELLMCGLGDVD
VSDWREHTKYKNGYSASHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGS
NGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences H0UUG7
XP_013010141.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]