SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0UUQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0UUQ7
Domain Number 1 Region: 219-482
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.28e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000232
Further Details:      
 
Domain Number 2 Region: 9-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000642
Family MarR-like transcriptional regulators 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0UUQ7
Sequence length 508
Comment (tr|H0UUQ7|H0UUQ7_CAVPO) Phenylalanyl-tRNA synthetase alpha subunit {ECO:0000313|Ensembl:ENSCPOP00000000705} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=FARSA OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MADGPVAEQLLRRLEVADGGLDSAELATQLGVEHQAVVGAVKSLQALGEVIEAELRSTKR
WELTAEGEEIAQEGSHEARVFRSIAPEGLAQSALMQLPSGKVGFSKAMSNKWIRVDKSAA
DGPRVFRVVEKVEDEVQRRLQLVQKGQAEKLSEKERSELRKRKLLTEVTLKTYWVSKGSA
FSTSVSKQETELSPEMISSGSWRNQPFKPYNFSARGVLPDSGHLHPLLKVRSQFRQIFLE
MGFTEMPTDNFIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPTDYVHRVKRTH
AQGGYGSQGYKYSWRLDEARKNVLRTHTTAASARALYRLAQKKPFTPVKYFSIDRVFRNE
TLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFSKLGITQLRFKPTYNPYTEPSMEVF
SYHQGLKKWVEVGNSGLFRPEMLLPMGLPENVSVIAWGLSLERPTMIKYGINNIRELVGH
KVNLQMVYDSPLCRLDTEPRPQKTQAAA
Download sequence
Identical sequences H0UUQ7
10141.ENSCPOP00000000705 ENSCPOP00000000705 ENSCPOP00000000705 XP_003468404.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]