SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0UWE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0UWE7
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 2.35e-50
Family Globins 0.000000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0UWE7
Sequence length 147
Comment (tr|H0UWE7|H0UWE7_CAVPO) Globin A1 {ECO:0000313|EMBL:SAI82225.1} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=GLNA1 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MVHLTAAEKSAILDLWGKVNVGEIGAEALGRLLVVYPWTQRFFEKFGDLSSASAIMSNAH
VKSHGAKVLASFSEGLKHLEDLKGTFAKLSELHCDKLHVDPENFRLLGNMIVIALAHHHP
SEFTPCTQAAFQKVTAGVANALAHKYH
Download sequence
Identical sequences H0UWE7
10141.ENSCPOP00000001378 ENSCPOP00000001378 XP_003465323.1.53824 ENSCPOP00000001378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]