SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0UZX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0UZX6
Domain Number 1 Region: 1117-1293
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 679-794
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.19e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 443-567
Classification Level Classification E-value
Superfamily PH domain-like 3.85e-26
Family Pleckstrin-homology domain (PH domain) 0.0000134
Further Details:      
 
Domain Number 4 Region: 1421-1559
Classification Level Classification E-value
Superfamily PH domain-like 1.89e-21
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 5 Region: 912-1030
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-21
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 6 Region: 6-74
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.53e-16
Family SAM (sterile alpha motif) domain 0.0000756
Further Details:      
 
Domain Number 7 Region: 577-678
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000128
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 1009-1109
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000268
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0UZX6
Sequence length 1697
Comment (tr|H0UZX6|H0UZX6_CAVPO) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCPOP00000002752} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=ARAP2 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MSSVSEVNIDIKDFLMSINLEQYLLHFQEFGFYTVKDCGGINDSVLHEIGISPTGHRRRI
LKKLQMILSNMQEIPIYANIRKTKNEGTSKDCHAPSSERNTCMEISVSGSTQTPSLTQLE
TVKNLDQNDIHMKKSQSFQADEKLALSEHDLPISEELHQNLDSRDSLSGKIESLLMKKTT
DGTVKEQPTEKVDLVSEDFSILPNADPECHFSWNCSASEAQSTSGPNGLVERSLPSPLFP
FQGEMVVNDLYVPSSPVLSPMRSRSKLVSRPSRSFLLRHRPVPDIPGATKGISGSYFRER
RTVTTSTGKSVTLPNSNEENSSSIFPYGETFLFQRLENSKKRCIKNEFWTHEQTLKGEAN
TSVNSFLIKSSIYDNRKEKISEDKVEDIWIPREDKNNLLQDSASESEYSTVEECFQSLRR
KNSKASKSRTQKALNMDPANRHSYPLNSTSGNAESSAVSSNAISPYACFYGSSTMKVKSG
WLDKLSPQGKRMFQKRWVKFDGLSISYYNNDKEMYSKGIIPLSAVSTVRVQGDNKFEVVT
TQRTFVFRAEKEEERNDWISILSNALKLHSLTSQSQVAVAPEKCGYLELRGYKAKIFTVL
KGSSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEK
QDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQH
RSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELQMDSPVEKRK
NFIIQKYREGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVH
STPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSDTGLSQEPAQATFLCDFLYQVPASAS
KVSSEKKILEETNKKWCVLEGGFLSYYENDKSTTPNGTINISEVICLAIHKEDFYLNTGP
VFIFEIYLPSERVFLFGAETSQAQRKWTETIAKHFVPFVAENLTEADYDLIGQLFYKDCH
ALDQWKKGWFAIDKSSLRFCLHMQEAQEDRMHLRRLQELTTSTVVQNGEKLDVLFLVEKG
RTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCK
YIYQKNGDPLHISELLENFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYP
YWVSALDTQDEKERIKKYGAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALV
FSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGD
LLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIVPTKGDIWATFEVIENEELER
PLHYTENILEQVLRWSALAEPGSAYLVVKRFLSLDTIKHYREKGIKEGVLKVKEEPSKLL
SGNKFQDRYFVLRDGCLFLYKDPKSSKHDKMFPLSSVKFYLGVKKKMKPPTSWGLTAYSE
KHHWHLCCDSSQTQMEWMASIFIAQHENDLWPPAGKERKRSITKNPKIGGLPLIPIQHER
NATQAGRNIESARAELERLRLSEKHDRETMDPSLKDRASIVAQCLEHKEDKLRNRTRKHR
SFVCLEDTESEVQQGQQKSHKGVKTLRKTEDKSNKAPLDSDHKLPSKVIEELNVVLQRSR
TLPKELQGEQISQKEIK
Download sequence
Identical sequences H0UZX6
XP_013005435.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]