SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0V731 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0V731
Domain Number 1 Region: 369-553
Classification Level Classification E-value
Superfamily NTF2-like 1.72e-65
Family NTF2-like 0.0000000131
Further Details:      
 
Domain Number 2 Region: 108-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.1e-36
Family Non-canonical RBD domain 0.00000518
Further Details:      
 
Domain Number 3 Region: 203-358
Classification Level Classification E-value
Superfamily L domain-like 7.48e-33
Family mRNA export factor tap 0.000000156
Further Details:      
 
Domain Number 4 Region: 550-618
Classification Level Classification E-value
Superfamily UBA-like 7.65e-26
Family TAP-C domain-like 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0V731
Sequence length 618
Comment (tr|H0V731|H0V731_CAVPO) Nuclear RNA export factor 1 {ECO:0000313|Ensembl:ENSCPOP00000005526} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=NXF1 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKYGDGNRRSGRGSSSVRSPRLEENDGDVAM
SETQDGPRVRYNPYSSRPNRRGDAWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFK
ITIPYGRKYEKSWLLSMIQSKCSVPFTPVEFHYENTRAQFFVEDASTASALKAVNYKIVD
RENRRISIIINSSAPPHTVQNELKPEQVEQLKLVMSKRYDGSQQALDLKGLRSDPDLVAQ
NIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGN
ELKSERELDKIKGLKLEELWLDGNTLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIA
FDVEAPTVLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIP
FIPQNPARSNLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVV
DISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASP
EEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQTFSTQSGMNLEWSQKCLQDNNWDYTRSAQ
AFTHLKAKGEIPEVAFMK
Download sequence
Identical sequences H0V731
10141.ENSCPOP00000005526 ENSCPOP00000005526 XP_003467959.1.53824 ENSCPOP00000005526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]