SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VE29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VE29
Domain Number 1 Region: 57-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.98e-79
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 407-500
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.71e-20
Family Anticodon-binding domain of Class II aaRS 0.0056
Further Details:      
 
Domain Number 3 Region: 5-57
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000169
Family a tRNA synthase domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0VE29
Sequence length 509
Comment (tr|H0VE29|H0VE29_CAVPO) Histidyl-tRNA synthetase {ECO:0000313|Ensembl:ENSCPOP00000008257} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=HARS OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MANCASLEELVRLQGEHVRSLKQQKANAEQIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMIPDAECLKIMCEILGSLQIGDFLVKVNDRRILDGMFAICGVPDSKFRTICSSVDK
LDKVSWEDVKNEMVGEKGLDPEVADRIGDYVQKHGGVSLVEQLLQDPKLSQNKQALGGLG
DLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGEEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEASEEKVRTTETQVLVASAQKKL
LEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRS
VASREEVDVRREDLVEEIRRRTSQPLCIC
Download sequence
Identical sequences H0VE29
XP_003477247.1.53824 10141.ENSCPOP00000008257 ENSCPOP00000008257 ENSCPOP00000008257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]