SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VI19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VI19
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000484
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0VI19
Sequence length 264
Comment (tr|H0VI19|H0VI19_CAVPO) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSCPOP00000009824} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=SBSPON OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MCALWLALCALARLWLGVLAGCAEAGRCCPGRDSACSVRGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSAWSGCADQCKPTTRVRRRSVRQEPQNGGAPCPPLEEQAG
CLEYSTKLGRDCGHAFVPAFITTSAFNKERTRQAASPQWSKHPEEPGYCMEFKTESLTPH
CALEHGPLTRWMQYLREGYTVCVDCQPPAMNAESLRCSGDGLDSDGNQSLHWQAIGNPRC
QGTWKKVRRVNQCSCPAVHSFIFI
Download sequence
Identical sequences H0VI19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]