SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VPC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VPC9
Domain Number 1 Region: 43-156
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 251-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 164-201
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  H0VPC9
Domain Number - Region: 366-413
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00236
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0VPC9
Sequence length 769
Comment (tr|H0VPC9|H0VPC9_CAVPO) LDL receptor related protein 3 {ECO:0000313|Ensembl:ENSCPOP00000012349} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=LRP3 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MEKRASAGPEGTPGTRAQLAVVCLVNLFLTGRLSSAVPAFAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQVSCQADEFRCDNGKCLP
GPWQCNTVDECGDGSDEGNCSAPASESPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSRDGDSSGSGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPY
RRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLHPGPGATPDLSAPCMDTGSP
RAPGDGPTSAPGHASEVGPSVTLPSGLQDPEYRAMDRERKACRDPLVDSPTTVDTAPESC
LAQDPLPQAPTASSTQGPHSAEPLGVCRSPLPPCSSMLEASDDEALLVC
Download sequence
Identical sequences H0VPC9
ENSCPOP00000012349 ENSCPOP00000012349 XP_003467256.2.53824 10141.ENSCPOP00000012349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]