SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VSE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VSE3
Domain Number 1 Region: 134-171,251-296
Classification Level Classification E-value
Superfamily SET domain 0.00000014
Family Histone lysine methyltransferases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0VSE3
Sequence length 299
Comment (tr|H0VSE3|H0VSE3_CAVPO) SET domain containing 9 {ECO:0000313|Ensembl:ENSCPOP00000013543} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=SETD9 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MPGRLLRGLWQRWSRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLETLLEVF
QALFLNDLNKQSDILTLLPQSVKSKYQDLLALQHHRVNLLENRHQLQNIFKPEEILYKTL
GFSVARATSSLISAGRGVFVTKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLD
GTLIDGNDKGISKVVYRSCSGRDRLGPLKMSDATWLTSEIHNPLAIGQYVNNCSNDRAAN
VCYQEFEVPAVFPIELKQYLPNIAYSYDTQSPLRCVVLVALRDIKQGEELFSNYYTIVS
Download sequence
Identical sequences H0VSE3
10141.ENSCPOP00000013543 XP_003470295.1.53824 ENSCPOP00000013543 ENSCPOP00000013543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]