SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VSR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VSR5
Domain Number 1 Region: 20-181,211-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.22e-68
Family BAR domain 0.0005
Further Details:      
 
Domain Number 2 Region: 265-297,328-385
Classification Level Classification E-value
Superfamily SH3-domain 6.02e-18
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0VSR5
Sequence length 386
Comment (tr|H0VSR5|H0VSR5_CAVPO) SH3 domain containing GRB2 like, endophilin B1 {ECO:0000313|Ensembl:ENSCPOP00000013682} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=SH3GLB1 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIM
KQTEILLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIK
CGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLK
KAKAAETRSSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISST
HAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSGTPVPSALPNAV
GSSAMASPSGLGITPASNVTDLKESSGSRKARVLYDYDAANSTELSLLADEVITVFSVVG
MDSDWLMGERGNQKGKVPITYLELLN
Download sequence
Identical sequences H0VSR5
ENSCPOP00000013682 ENSCPOP00000013682 10141.ENSCPOP00000013682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]