SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0VUK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0VUK8
Domain Number 1 Region: 475-760
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.38e-60
Family Eukaryotic proteases 0.000000000614
Further Details:      
 
Domain Number 2 Region: 204-473
Classification Level Classification E-value
Superfamily vWA-like 9.49e-57
Family Integrin A (or I) domain 0.0000000164
Further Details:      
 
Domain Number 3 Region: 100-161
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.0000336
Further Details:      
 
Domain Number 4 Region: 166-222
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0000437
Further Details:      
 
Domain Number 5 Region: 46-86
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0VUK8
Sequence length 766
Comment (tr|H0VUK8|H0VUK8_CAVPO) Uncharacterized protein {ECO:0000313|Ensembl:ENSCPOP00000014382} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=Cfb OC=Hystricomorpha; Caviidae; Cavia.
Sequence
AAMGHSVGPWLCLAPLVLGLWSGGVSSTTLPTSRPWSPCSLEGIEIKGGSFQLLKQGRAL
EYVCPSGFYPYPVQTRICRSTGNWSSLKTQDHKIVKKAECRAIHCPRPQEFENGDYWPRS
LHYNVSDEISFHCYNGYTLRGSANRTCQANGRWDGQTAICDDGAAYCPNPGIPIGMRKVG
SQYRLEDTVTYHCSRGLMLRGSQQRKCQESGSWSGTEPSCQDSFMYDTPQEVAEAFLSSL
TETIEGVDAEDGHSPGEQQKRRIILDPAGSMNIYLVLDGSDSIGASNFTGAKRCLASLIE
KVASYGVKPRYALVTYATEPKVLVSVVQDKSSDADWVTEKLNKISYEDHKLKSGTNTKRA
LQEVYNMMNLAVDSQPGSWNRTRHVIILMTDGLYNMGGDPVTIIHDIRYLLDIGRDRKNP
REDYLDVYVFGVGPLVDQVNINALASKKDGEQHVFKVRDMEHLEDVFFQMIDESQALGLC
GMVWEHRKGTDYHKHPWQAKISVTRPQKGHENCMGAVVSEYFVLTAAHCFTVEDQKHSIK
VNVGGKRQDLEIEEVLFHPKYNINAKKEQGILEFYDYDVALVKLKNKVTFSQTLRPVCLP
CTLGTTRALRLPPTATCRQHKEELLPAKDVKALFISEEQKKLTRKEVYIKNGEKKAGCEQ
DAKHATGYDKIKDISEVVTPRFLCTGGVDPYDDPNTCKGDSGGPLIIHKRSRFIQVGVIS
WGVVDVCYHRKRQQRVPAYARDFHVNLFQVLPWLKEKLKDENLDFL
Download sequence
Identical sequences H0VUK8
ENSCPOP00000014382 ENSCPOP00000014382 10141.ENSCPOP00000014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]