SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0W0C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0W0C9
Domain Number 1 Region: 33-146
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000488
Further Details:      
 
Domain Number 2 Region: 433-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000405
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 
Domain Number 3 Region: 241-305,353-373
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000327
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0W0C9
Sequence length 505
Comment (tr|H0W0C9|H0W0C9_CAVPO) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSCPOP00000016414} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=WAS OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MSGGPVGGRPGSRAGAAQNIPSSLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAQ
HWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLAPTSFFHTFAGDDC
QVGLNFADEGEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPPPGNEERRGGLPPLPSHPS
GDQGGPSAGSVSLGLLTVDIHNPDITSSRYRGLPAPSPSPADKKRSGKKKISKADIGAPK
DFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRTGNQRRPSSQDGRELPILIYDFIENQGRT
GGSAARDEAAGVKPLPPPPPPCRGGNQPTRPPVVGGNKGRSGPLPPVPLGAAPPPPTPRG
PPPPGRGGPPPPPPPATGRSGQPPPPLSGAGGPPVPPPPPAPPLPPTSTGGGPVPPPPPP
TLGSGGGLAPGGGRGALLDQIRQGIQLNKTLGAMESAAVQPPPQSSDGLVGALMHVMQKR
SRVIHSSDEGEDQAGDDDEDDEWDD
Download sequence
Identical sequences H0W0C9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]