SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WFJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WFJ9
Domain Number 1 Region: 649-825
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-41
Family DBL homology domain (DH-domain) 0.0000891
Further Details:      
 
Domain Number 2 Region: 835-950
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-35
Family Pleckstrin-homology domain (PH domain) 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WFJ9
Sequence length 1110
Comment (tr|H0WFJ9|H0WFJ9_OTOGA) Pleckstrin homology and RhoGEF domain containing G4 {ECO:0000313|Ensembl:ENSOGAP00000000015} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PLEKHG4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MEGPLKDGDEFPDSRGHATDWRFAVCSFRHAWEEEEPTPQMQVKDPKPLRPPAGAAQGDG
IQSSSLSRELQLPPVQMASDGSGDAQKITLEGSSVLSEELVPTGVESLLCSMSSHLSLAQ
GENDNPGIGLVGDPDPNRVIPASLGHGRLDSDPVDLEDTLSETSSTLMEPDSSRSNLPKP
ADCLLAQDLTWELLASGMAALPGTRDIEGRAVLLLCAHSPAWLHPKCSSHELIRLLLYLR
NIPRFACPSFSQRLEALLQSCQEVCALLQGAIESMKAVPQPTESGEVGRLLRQARVLMQQ
VLDSPRLAWLQCQGGTELEWLKQEVPEVTLSPDYRPAVDKAGELYGRVDRLLHHLTLQGN
QRVQALELVQTLEAQEGRLHQIEVWLQQVGWPALEEPAEPSLDMLLQAQGPFWELDQVAQ
EQVSQGEKFLQPLAGWEAADLGPQGARFLDLQAQLTEFSRALAQRRQRLADAERLFQFFK
QASTWAEEGQRVLAELEQERPGAVLQQLQLHWTRHPDLPPAHFRKMWALATGLGSEGIRQ
ECRWAWAQCQDTWLALDQKLEAALKPPPVGSTASLCVSRISSVPAPPPLRKAYSFDRNLG
KSLSKPTHHYHHAAIVTPCHGPEATGDAQPQPSPCVLPPGSSDPKSPSRLQLVLAEMVTT
EREYVRALDYTIDNYFPELDRPDVPQGLRGQRAHLFGNLEKLRDFHCHFFLRELEACTRH
PPRVAYAFLRHRVQFGMYALYSKNKPRSDALMSSYGHAFFKDKQQALGDHLDLASYLLKP
IQRMSKYALLLQELARACGGSMQELSALRAAQSLVHFQLRHGNDLLAMDAIQGCDVNLKE
QGQLVRQDEFMVRTGRRKSLRRVFLFEDLLLFSKPRRGPAGVDTFAYKRSFKMADLGLTE
CCGDSNLRFEIWFRRRKARDTFVLQASSLATKQAWTTDISRLLWRQAVHNKEVRMAEMVS
MGVGNKAFQDIAPSEEAINDRTINYILKCREVRSRASIAVAPFDCDSSYLGVSSSTLPGD
PASCSVLGSLNLHLYRDPALLDLRWPLYPPNFPEEAELEAEVELGSQPSLTPEDSEVLSQ
CPSASGSSGSDSSCVSGQALGRGFEDLSYV
Download sequence
Identical sequences H0WFJ9
ENSOGAP00000000015 ENSOGAP00000000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]