SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0WH32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WH32
Domain Number 1 Region: 166-269
Classification Level Classification E-value
Superfamily POZ domain 3.73e-18
Family Tetramerization domain of potassium channels 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WH32
Sequence length 475
Comment (tr|H0WH32|H0WH32_OTOGA) BTB domain containing 10 {ECO:0000313|Ensembl:ENSOGAP00000000661} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=BTBD10 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MAGRPHPYDSNSSDPENWDRKLHSRPRKLYKHSSTPSRVAKGGVDHTKMSLHGASGGHER
SRDRRRSSDRSRDSSHERTESQLTPCIRNVTSPTRQHHVEREKDHSSSRPSSPRPQKASP
NGSISSAGNSSRNSSQSSSDGSCKTSGEMVFVYENAKEGARNVRTSERVTLIVDNTRFVV
DPSIFTAQPNTMLGRMFGSGREHNFTRPNEKGEYEVAEGIGSTVFRAILDYYKTGIIRCP
DGISIPELREACDYLCISFEYSTIKCRDLSALMHELSNDGARRQFEFYLEEMILPLMVAS
AQSGERECHIVVLTDDDVVDWDEEYPPQMGEEYSQIIYSTKLYRFFKYIENRDVAKSVLK
ERGLKKIRLGIEGYPTYKEKVKKRPGGRPEVIYNYVQRPFIRMSWEKEEGKSRHVDFQCV
KSKSITNLAAAAADIPQDQLVVMHPTPQVDELDILPMHPPSGNNDLDPDAQNPML
Download sequence
Identical sequences H0WH32
XP_003781162.1.62490 ENSOGAP00000000661 ENSOGAP00000000661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]