SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WHI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WHI5
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.31e-80
Family Proteasome subunits 0.00000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WHI5
Sequence length 248
Comment (tr|H0WHI5|H0WHI5_OTOGA) Proteasome subunit alpha type {ECO:0000256|RuleBase:RU000551} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PSMA7 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKHYTDDA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
Download sequence
Identical sequences H0WHI5
ENSOGAP00000000833 XP_003787803.1.62490 ENSOGAP00000000833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]