SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WJP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WJP2
Domain Number 1 Region: 418-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-26
Family SPRY domain 0.0075
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily RING/U-box 4.2e-16
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 3 Region: 168-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000198
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WJP2
Sequence length 636
Comment (tr|H0WJP2|H0WJP2_OTOGA) Tripartite motif containing 47 {ECO:0000313|Ensembl:ENSOGAP00000001728} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TRIM47 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MDSSGPFSCPICREPLREPVTLPCGHNFCLACLGVLWPHRGSGGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPAPEPSAPSAPPSTPEPSAPCAPEPWPA
GEEPVPCDACPEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRRLEESLC
PRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQPKVLSAVEDRMDEL
GAGIAQARRTVALIKSAAVAERERVSRLFAEAAITLQGFQNQVLGFIEEGEAAMLGRSQG
DLRRQEEQRSRLTRARHNLNQVPEADSVSFLQELLALRLALEEGCGPGPGPPRELSFTKS
SQAVRAVRDVLAEVCASQWEQLQGLGSDEDGPQKLGSEADAESQDPDSTNQLESEAPRDY
FLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPESPTRFTHCEQVLGEGALDRGTY
YWEVEIIEGWVSVGVMAEGFNPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGLEAPLPQ
PFSPTVGICLEYADRALAFYAVRDGKMSLLRRLKASRPRRSGIPASPVDPFQSRLDSHFA
GLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences H0WJP2
XP_003786170.1.62490 ENSOGAP00000001728 ENSOGAP00000001728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]