SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WKB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WKB8
Domain Number 1 Region: 35-165
Classification Level Classification E-value
Superfamily Lysozyme-like 1.76e-19
Family G-type lysozyme 0.0000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WKB8
Sequence length 177
Comment (tr|H0WKB8|H0WKB8_OTOGA) Lysozyme g2 {ECO:0000313|Ensembl:ENSOGAP00000002002} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=LYG2 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MMSSVMLWGLIGLIGTLVDSYLFTHLMSPHPNPHHGCYGDIMTMETLGPSCDLNTLISCG
IRGSEMFVEMDLRAINPYQTLIKEVGQRHCVDPAVIAAIISRESRGGTTLRDGWEHRGLK
LGLMQLDKQIYHPAGTWDSKEHLLQAVGILTDGIKIIQKNFPTWSAAQHFKGKFFLL
Download sequence
Identical sequences H0WKB8
ENSOGAP00000002002 ENSOGAP00000002002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]