SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WL40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WL40
Domain Number 1 Region: 645-755
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000028
Family Regulator of G-protein signaling, RGS 0.0074
Further Details:      
 
Domain Number 2 Region: 374-493
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000353
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Weak hits

Sequence:  H0WL40
Domain Number - Region: 877-982
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000542
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number - Region: 83-196
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00706
Family Regulator of G-protein signaling, RGS 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WL40
Sequence length 1080
Comment (tr|H0WL40|H0WL40_OTOGA) Regulator of G protein signaling like 1 {ECO:0000313|Ensembl:ENSOGAP00000002337} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=RGSL1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
SLHVEIIASTNLIILLEDEVFADFFNTFLSLPVFGQTPMYTVENSQWSLWPEIPSDTVAK
YKGLLTWLEKYRLPFFCKTNLCFHYILCQELISFIKSPEGGEDLVDFWILAEKILSIDET
DIEVRDYYLSLLLMLKATHLQEGSRVVTLCRMNIKSLLNLSIWHPNQTTSRREILSHMQK
VALFKLQSYWLPNFYTHAKMAMAKEEACQGLMQEYETRLCSICCSHTGGLPLNMTIKKND
HFQKEYSSRKTKRKMWQLINPGSWFLEMDCEPDTNIVPPQERRPQEKVVKQMPPLRVASS
KEKIINLPEKRSHSARKLSMKKKAKRHLHMEGLFETKFTTHLRIATPFTHYSSQVTMKRA
IKQSLCIGYTHWALCADAYAGSPFRSHLKKQNLKVETQLLDLWQDLHHFLGVLMNNRKNG
NAVFRHMLGNRICELYLNEQIGPPLPLKSQIIQGLKELLPYGNVNPWIPKAQKEICKILR
PWYDEFLNEEDYCFLSFTTQNRLISSIRPKRDTISKEENILLCKRVQESLELSHALATTE
KMDSMQWQKIATEDLRQGGSLQVELSPPMFLFTDISKMSFEELCCKYPKIAIEKISDDYK
TYCERAPHIDYPVEIVKEPKVVRLSLSRKMSVFKKSGLRKPSMRPRNMTEVLLNSQHVEY
FREFLKERKAESPLDFLVAVQRIVIETNEKAYKSLLENLLKTFFQSDVSPEEILQCDAPL
IREVANMRHVSTTMLLMLQSFIMKSVEEKWFKDYQELFPARPVETETQIQPSPRKPSRTA
TTHLQESQKRGWMKMINFIRSFCKYRRFMSDPNKRQEFEDFLHLEMQISKDNFSVSTNTS
GRSALFPANVRNIEQENGEMTFVKRRIYGHRLITVNFAINDIYFFSEMEKFNDLVSSAQM
LLVNRTYSENDVLLMRSKINIILKLFLHSDIPPKLRVNIPESQKDSIITAITEGHLDRSI
FHGAIMSLFPVVMYFWKRYCAWKVITSYFQYLGKKVKERKGPPKTTYKYPPSTGGKEDQA
ILRFTLLRGIEWLRPQHREVTINSVQNSSSSNLTHSGLTLPTVQMCPVPGHKVHGNKKKR
Download sequence
Identical sequences H0WL40
ENSOGAP00000002337 ENSOGAP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]