SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WL43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WL43
Domain Number 1 Region: 55-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.5e-45
Family Regulator of G-protein signaling, RGS 0.000000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WL43
Sequence length 202
Comment (tr|H0WL43|H0WL43_OTOGA) Regulator of G protein signaling 16 {ECO:0000313|Ensembl:ENSOGAP00000002340} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=RGS16 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGSDTGSVGKFEWGSKHSKESRNFPEDVL
GWKESFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLTSRAQRIFEE
FICSEAPKEVNIDHETRELTRTNLQAATATCFDVAQGKTRTLMEKDSYPRFLKSPAYRDL
AAQASAASVSLSGSSPAEPSHT
Download sequence
Identical sequences H0WL43
ENSOGAP00000002340 XP_003785694.1.62490 ENSOGAP00000002340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]