SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WM89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WM89
Domain Number 1 Region: 159-472
Classification Level Classification E-value
Superfamily RNI-like 3.66e-47
Family Cyclin A/CDK2-associated p19, Skp2 0.0052
Further Details:      
 
Domain Number 2 Region: 97-147
Classification Level Classification E-value
Superfamily F-box domain 1.23e-17
Family F-box domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WM89
Sequence length 481
Comment (tr|H0WM89|H0WM89_OTOGA) F-box and leucine rich repeat protein 7 {ECO:0000313|Ensembl:ENSOGAP00000002838} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXL7 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
SPGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNG
RGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASVDRLPDQCMVHVFSFLP
TNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLET
VTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSK
VTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVR
LTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGVRY
VAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNL
KRLSLKSCESITGQGLRIVAANCSDLQMLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAF
F
Download sequence
Identical sequences H0WM89
ENSOGAP00000002838 ENSOGAP00000002838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]