SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WMH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WMH0
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 4.15e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000497
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.41e-30
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 431-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000262
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WMH0
Sequence length 503
Comment (tr|H0WMH0|H0WMH0_OTOGA) Wiskott-Aldrich syndrome {ECO:0000313|Ensembl:ENSOGAP00000002937} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=WAS OC=Lorisiformes; Galagidae; Otolemur.
Sequence
TMSGVTVGGRPGGRGGSAAQNIPSTLLQDHENQRVFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEGEAQAFQALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGGLPPLPPH
PGGDQGGPPAGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGGAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPPPPPPPGAGGPPLPPPPPPPPLPPPSTGDGPAPPPPPPTL
VPGGGLAPGGGRGALLDQIRQGIQLNKTSGSLESSTLQPPPQSSEGLVGALMHVMQKRSK
VIHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences H0WMH0
ENSOGAP00000002937 ENSOGAP00000002937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]