SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WMI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WMI3
Domain Number 1 Region: 374-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-75
Family Protein kinases, catalytic subunit 0.0000000141
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-44
Family Pleckstrin-homology domain (PH domain) 0.0000492
Further Details:      
 
Domain Number 3 Region: 270-416
Classification Level Classification E-value
Superfamily SH2 domain 1.04e-32
Family SH2 domain 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WMI3
Sequence length 656
Comment (tr|H0WMI3|H0WMI3_OTOGA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=BMX OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MDTKPILEELLLKRSQQKKKMSPSNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHIAVNEEKHRLPTFPDRVLKIPRAVPVF
RMHAPSSSTTPAQYDSSDSKKNYGSQLNVNMCIPQEDYPDGWQVRKLKRSLSTEDVACSN
QKERNVANHRTSKISSGFPESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMV
RNSSQAGMYTVSLFSKAVNDKKGTVKHYHVHTNAEKKLYLAENYCFDSIPKLIHYHQHNS
AGMITRLRHPVSTKANKVPVSVSLGTGMWELKREEITLLKELGSGQFGVVQLGKWKGQYD
VAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNYL
RSHGKGLETSQLLEMCYDVCEGMAFLESQQFIHRDLAARNCLVDSDLSVKVSDFGMTRYV
LDDQYVSSVGTKFSVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQV
VVKVSQGHRLYRPQLASDTIYQIMYSCWHEAMLPEKRPTFQQLLSSIEPLREKDRP
Download sequence
Identical sequences H0WMI3
ENSOGAP00000002951 ENSOGAP00000002951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]