SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WP11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WP11
Domain Number 1 Region: 47-259
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.24e-60
Family Proteasome subunits 0.00000000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WP11
Sequence length 264
Comment (tr|H0WP11|H0WP11_OTOGA) Proteasome subunit beta {ECO:0000256|PIRNR:PIRNR001213} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PSMB4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MESFLEPWSGLWAGGPAPGQFYRIPCTPSSSMDPASALSGRPITRTLNPMVTGTSVLGVK
FEGGVVIAADMLGSYGSLARFRNISRIMKVNDSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPKAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEAQELVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSAETNWDIAHMISGFE
Download sequence
Identical sequences H0WP11
ENSOGAP00000003600 ENSOGAP00000003600 XP_003800419.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]