SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H0WQ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WQ68
Domain Number 1 Region: 374-646
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-67
Family Kelch motif 0.000085
Further Details:      
 
Domain Number 2 Region: 82-209
Classification Level Classification E-value
Superfamily POZ domain 9.03e-27
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WQ68
Sequence length 653
Comment (tr|H0WQ68|H0WQ68_OTOGA) Kelch like family member 29 {ECO:0000313|Ensembl:ENSOGAP00000004080} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KLHL29 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPAQPSATVPSSAPATN
GPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEV
HQNVLASCSLYFKDLIQRSVQDGGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSA
NAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQI
FPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPASRAQYAAELLAV
VRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGV
AEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSG
GMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER
YDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYIPQTNTWSFIE
SPMIDNKYAPAVTLNGFVFILGGAYARATTIYDPDKGNIKAGPNMNHSRQFCSAVVLDGK
IYATGGIVSSEGPALGNMEAYEPTTNTWTLLPHMPCPVFRHGCVVIKKYIQSG
Download sequence
Identical sequences H0WQ68
ENSOGAP00000004080 ENSOGAP00000004080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]