SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WRB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WRB2
Domain Number 1 Region: 108-355
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-40
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 45-83
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WRB2
Sequence length 717
Comment (tr|H0WRB2|H0WRB2_OTOGA) F-box protein 42 {ECO:0000313|Ensembl:ENSOGAP00000004556} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO42 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MASSSDSEDDSFMAVDQEETVLEGTMEQDEEPRPLLEVEETRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SGSREGSLSPARGDGSPILNGGSLSPGTAAVSGSSLDSPVQAISPSTPSAAEGYDLKMGL
SLASRRGSLPDQKDLRLGSIDLNWDLKSASSSNHMDGMDNRTVGGSMRHPPEQMNGVHTP
PHVASALAGAVSPGALRRSLEAVKAMSSKGPSTSAALSPPLGSSPGSPGSQNLSSGETVP
IPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRV
KWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Download sequence
Identical sequences H0WRB2
ENSOGAP00000004556 XP_003783920.1.62490 ENSOGAP00000004556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]