SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WS16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WS16
Domain Number 1 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.65e-55
Family Decarboxylase 0.000000565
Further Details:      
 
Domain Number 2 Region: 14-204
Classification Level Classification E-value
Superfamily PRTase-like 2.98e-44
Family Phosphoribosyltransferases (PRTases) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WS16
Sequence length 480
Comment (tr|H0WS16|H0WS16_OTOGA) Uridine monophosphate synthetase {ECO:0000313|Ensembl:ENSOGAP00000004854} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=UMPS OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MEAAGDALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQIADILFQT
AQNEGISFDTVCGVPYTALPLATVMCSTNQIPMLIRRKETKDYGTKRLVEGAVNPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAVVLLDREQGGKDKLQAHGIRLHSVCTLSRIL
EILEQQKKIDTEMVGRVKRFVQENVFVTTNQNGSLLCIKKASKELSFGARAELPGIHPVA
SKLLRLMQRKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILDDFTLDVMEELTM
LAQRHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADVVNAHVVPGSGVVKGLREVGLP
LHRGCLLIAEMSSAGSLATGNYTKAAVRMAEEHSEFVIGFISGSRVSMKPEFLHLTPGVQ
LEAGGDTLGQQYNSPQEVISKRGSDIIIVGRGIISAANRLEAAEIYRKVAWEAYLNRLGI
Download sequence
Identical sequences H0WS16
ENSOGAP00000004854 XP_003795119.1.62490 ENSOGAP00000004854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]