SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WSG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WSG4
Domain Number 1 Region: 187-523
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-78
Family Protein kinases, catalytic subunit 0.000000602
Further Details:      
 
Domain Number 2 Region: 33-183
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.87e-38
Family Regulator of G-protein signaling, RGS 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WSG4
Sequence length 581
Comment (tr|H0WSG4|H0WSG4_OTOGA) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GRK4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MEMENVLANAMLLKARLTLGGYGKKNGRSKKWREMLKLPLVSQCKELRSSIEKDYCSLCD
KQPIGRLLFRQFCDTKPKLKRCIEFLDAVAEYEVAEEEDQSDFGLSVLNKFFSKECAVLL
PEVTSRMVKECRAQLLKDPSKTVFEELTRVVHKYLSGTPFEEYQESSYFSHFLQWKLLER
QPVTKHTFRHYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKRIL
EKVHSRFVVSLAYTYETKDTLCLVLTIMNGGDLKFHLYNLGNPGFDEQRAVFYAAEVCCG
LEDLQKERIAYRDLKPENILLDDRDKGHIRISDLGLAVEIPEGHSVRGRVGTIGYMAPEV
INNEHYTFSPDWWGLGCLIYEMIQGHTPFRKLKEKVRREEVDRRVRKDTEEYSEKFSEAT
RSICRMLLTKNPQERLGCKGDGAAGVKQHPVFKDINFKRLEANMLDPPFCPDPKAVYCKD
ILDIGHFSTVRGVYLDTTDNSFYAQFVTGCVSIPWQNEMIESGCFKDINESENDDTFRSD
IEEKQLVRVSKPKKGFFYRLFRRGGCLTPGYSEQDPEPMMR
Download sequence
Identical sequences H0WSG4
ENSOGAP00000005025 ENSOGAP00000005025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]