SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WSL9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WSL9
Domain Number 1 Region: 370-598
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-60
Family DBL homology domain (DH-domain) 0.00000057
Further Details:      
 
Domain Number 2 Region: 51-207
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.06e-53
Family Regulator of G-protein signaling, RGS 0.0000000933
Further Details:      
 
Domain Number 3 Region: 599-733
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-39
Family Pleckstrin-homology domain (PH domain) 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WSL9
Sequence length 941
Comment (tr|H0WSL9|H0WSL9_OTOGA) Rho guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSOGAP00000005086} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ARHGEF1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
SPAEPREEMEDVAGGVPPGPPKPGLVPISIIGAEDEDFENELETSSELQNSQFQSLEQVK
RRPAHLMALLQHVALQFEPGPLVLRVSVPPSVAFELDRTRPDLLSEDVQRRFVQEVVQSQ
QAVVGRQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASFEARERHVAERLLTHLEEMQH
TISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPPKTKKGLS
SILDAARWNRGEPQAPDFRHLKGEVDAEKPGLTDRKGVLGMPSRDRNLGAPGQDSPGVSL
HSLSGDSPDREAGADTPLELGDPPLQGPTSLEPPAPPESIEEGAETESPEPGDEAEPGRS
GLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFYQPM
ADGGFFSLEELQNIFPSLDELIEVHSLFLDRLMKRRQDSGYLIEEIGDVLLARFDGAEGS
WFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQEAESRPRCRRLQLKDMIPTEMQRLT
KYPLLLQSIGHNTEEPTEREKVERAAECCREILHHVNQAVRDMEDLLRLKDYQRRLDLSH
LRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLL
LKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVAQTVS
ERKNWCALITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSENGNGGREMPPADARTER
ILNDLLPFCRPGPEGQLAATALRKGVGGGILPPATPPVSARGEPCPQSWLHLRPLSRQAF
CKERNGERTCRGPPPPTHTASISYPEGLKRGSCCRSCLGEAQLGSLCPHWPQSSLPPACL
GEDSGLHGGHHSDPQVPGYLSIVCGGHPSTPPKCLCSVFIP
Download sequence
Identical sequences H0WSL9
ENSOGAP00000005086 ENSOGAP00000005086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]