SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WVD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H0WVD9
Domain Number - Region: 143-381
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00193
Family Penicillin V acylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WVD9
Sequence length 395
Comment (tr|H0WVD9|H0WVD9_OTOGA) N-acylsphingosine amidohydrolase 1 {ECO:0000313|Ensembl:ENSOGAP00000006272} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ASAH1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MLGQTHLRLVLLTAAVTYTVAQHAPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYK
RWHELMADKAPQLKVIVNSLKNIVNAFVPSGKVMQMVDQKLPGLLGNFPGPFEEEMKGIA
AVTDIPLGEIISFNIFYEFFTMCTSIITEDKVGHLLHGRNMDFGVFLGWNINNNTWVVTE
ELKPLTVNLDFQRNNKTVFKASSFAGYVGMLTGFKPGLFSLTLNERFNMDGGYLGILEWI
LGKKDAMWIGFITRSVLENSTSYEEAKNILTKTKILAPAYFILGGNQSGEGCVITRGRKE
SLDIYDLDPKYGRWYVVQTNYDRWKSPFFLDDRRTPAKMCLNRITQENISFATLYDVLST
KPVLNKLTAFTTLIDVTRGQYETYLRDCPDPCIGW
Download sequence
Identical sequences H0WVD9
ENSOGAP00000006272 ENSOGAP00000006272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]