SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WVF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WVF6
Domain Number 1 Region: 303-387,478-512,561-657
Classification Level Classification E-value
Superfamily RNI-like 1.15e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.04
Further Details:      
 
Domain Number 2 Region: 181-266
Classification Level Classification E-value
Superfamily F-box domain 3.92e-19
Family F-box domain 0.0026
Further Details:      
 
Weak hits

Sequence:  H0WVF6
Domain Number - Region: 507-551
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0765
Family Blood coagulation inhibitor (disintegrin) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WVF6
Sequence length 668
Comment (tr|H0WVF6|H0WVF6_OTOGA) F-box and leucine rich repeat protein 5 {ECO:0000313|Ensembl:ENSOGAP00000006290} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXL5 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
LLCVKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDN
KLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFT
YEELKDIKKKVIAQHCSQKDTAELLRGLSLWNQAEERQKFFKYSVDEKSDKEAEVSEHST
GITHLPPEVMLSIFSYLNPQELCRCSQVSTKWSQLAKTGSLWKHLYPVHWARGDWYSGPA
TELDTEPDEEWVKNRKDESRAFHEWDEDADIDESEESAEESVAISIAQMEKRLLHGLIHN
VLPYVGPSVKTLVLAYSSAVSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQ
SLRHLDLSGCEKITDVALEKISRALGILTSHQSGSLKASASKITSTMWKNKDITTHSTKQ
YACLHDLTNKGVGEEIDNEHPWTKPVPAENFTSPYVWMLDAEDLADIEDAVEWRHRNVES
LCVMDTASSFSCPTSACYSKDIVGLRTSVCWQQHCASPAFAYCGHSFCCTGTTLRTMSAL
PESSAICRKASRTRLTEGKDLIYFGSEKSDQETGRVLLFLSLSGCYQITDHGLRVLTLGG
GLPFLEHLNLSGCLTVTGAGLQDLVSACPSLNDEYFYYCDNINGPHADTASGCQNLQCGF
RACCRSGE
Download sequence
Identical sequences H0WVF6
ENSOGAP00000006290 ENSOGAP00000006290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]