SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WVR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WVR7
Domain Number 1 Region: 4-32,84-152
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-22
Family Voltage-gated potassium channels 0.0058
Further Details:      
 
Domain Number 2 Region: 156-268
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-19
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WVR7
Sequence length 393
Comment (tr|H0WVR7|H0WVR7_OTOGA) Potassium two pore domain channel subfamily K member 4 {ECO:0000313|Ensembl:ENSOGAP00000006417} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KCNK4 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MRSTTLLALLALVLLYLVSGALVFQALEQPQEQQAQRELGEARERFLKAHPCVSNQELGL
FIQEVADALGGGANPETNSTSNSSHSAWDLGSAFLFSGTIITTIGYGNVALRTDAGRLFC
IFYALVGIPLFGILLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC
LLFVLTPTFVFCYMENWSKLEAIYFVIVTLTTVGFGDYVAGADPKQDFPAYQPLVWFWIL
LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPTAPPPEKE
RPLLPPPPCPEQPVGRPRPPTSPEKPEPPSSPTASALDYPSENLAFIDESSDTQSERGCA
LPHVPRGRRRPNPSRKPARPRGPGRPREKGVPV
Download sequence
Identical sequences H0WVR7
ENSOGAP00000006417 ENSOGAP00000006417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]