SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WW64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WW64
Domain Number 1 Region: 8-219,325-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-47
Family FAD-linked reductases, N-terminal domain 0.0000543
Further Details:      
 
Domain Number 2 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.77e-25
Family D-aminoacid oxidase-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WW64
Sequence length 392
Comment (tr|H0WW64|H0WW64_OTOGA) Pipecolic acid and sarcosine oxidase {ECO:0000313|Ensembl:ENSOGAP00000006604} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=PIPOX OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MAAQKDFWDAIVLGAGIQGCFTAYHLAKHRKQVLLLEQFFLPHSRGSSHGQSRIIRKAYA
DDFYTQMMDECYRIWAQLEQESGTQLYRKTGLLLVGPKENPELKTIQATLSRQRIEHQCL
SSEELKQHFPNIRLPQGEVGLLEKSGGVLYADRALRTLQDAVRQLGGTVRDGEKVMEIKP
GLPVVVKTSCGSYQAKSLIITAGPWTNCLLRPLGIELPLQTLRINVCYWREKSPGSYGVV
PAFPCFLGLGQAPHHIYGLPEGEYPGLVKVCYHHGNHTDPDERDCPTARPDIQDVQILCR
FVKDHLPGLKPEPAIMERCMYTNTPDEHFILDRHPKYDNIVIGAGFSALGHGFKLAPVVG
KILYELSMKLTPSYDLTPFRISRFHGLGKAHL
Download sequence
Identical sequences H0WW64
ENSOGAP00000006604 ENSOGAP00000006604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]