SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WW88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WW88
Domain Number 1 Region: 166-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.84e-21
Family Ankyrin repeat 0.0029
Further Details:      
 
Weak hits

Sequence:  H0WW88
Domain Number - Region: 583-718
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00361
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WW88
Sequence length 793
Comment (tr|H0WW88|H0WW88_OTOGA) Transient receptor potential cation channel subfamily V member 3 {ECO:0000313|Ensembl:ENSOGAP00000006632} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=TRPV3 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MNAHPREMVPLIGRRVAAPSGNPAVLPEKRPVEVTPTKKSAHFFLEIEGFEPNPTVTKTS
PPIFSKPMDSNIRQCLSGNCDDMDSPQSPQDDMTETPSNPNSPSLSANLAKEEQRRKKKR
LKKRIFSAVSEGCVEELLELLGELQELCKRRRGLDVPDFLMHKLTASDTGKTCLMKALLN
INPSTKEIVRILLAFAEENDILDRFINAEYTEEAYEGQTALNIAIERRQGDITAVLIAAG
ADVNAHAKGVFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEYEQTNIASQDSRGNN
ILHALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETVRNNDGLTPLQLAAKMGKAEILK
YILSREIKEKPLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEIIVYNTNIDNRHE
MLTLEPLHTLLHMKWKKFAKYMFFLSFCFYFFYNITLTLVSYYRPREEEALPHPLALTHK
MGWLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVF
LYLFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFL
LGFGVALASLIEKCPNDNKDCSSYGSFSEAVLELFKLTIGLGDLNIQQNSKYPVLFLFLL
ITYVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMG
ELCKVAEEDFRLCLRINEVKWTEWKTHVSFLNEDPGPVKRTADFNRIQDSSRSNSKTTLN
AFDEIDEFPETSV
Download sequence
Identical sequences H0WW88
ENSOGAP00000006632 ENSOGAP00000006632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]