SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WWK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WWK5
Domain Number 1 Region: 239-457
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-87
Family Fibrinogen C-terminal domain-like 0.00000069
Further Details:      
 
Weak hits

Sequence:  H0WWK5
Domain Number - Region: 119-155
Classification Level Classification E-value
Superfamily GAF domain-like 0.0161
Family GAF domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WWK5
Sequence length 461
Comment (tr|H0WWK5|H0WWK5_OTOGA) Fibrinogen C domain containing 1 {ECO:0000313|Ensembl:ENSOGAP00000006768} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FIBCD1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MVNDRWKTMGGASQLEDRPRDKPQRPSCGYVLCTVLLSLAVLLAVAVTGAVLFLNHAHAP
GTAPPPIVSTGAAGVNSALVTVERADSSHLSILIDPRCPDLSDGFARLEGAQASVLQALA
VHQAQPRLPGEQEQELLDTLAEQLPRLLSRASELQEECVGLRKGHGTLGQGLSALQSEQG
RLLQLLSESQGHMAHLVNSVSDVLDALQRDRGLGRPRVKADLQRAPARGARPRGCAGGSR
PRDCLDVLLSGQQDDGVYSVFPIHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWE
AYRDGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPE
EDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYHGAWWYRNCHTSNLN
GQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPVREDH
Download sequence
Identical sequences H0WWK5
ENSOGAP00000006768 ENSOGAP00000006768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]