SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WX19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WX19
Domain Number 1 Region: 3-207
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-45
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 195-323
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000487
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WX19
Sequence length 323
Comment (tr|H0WX19|H0WX19_OTOGA) Rho guanine nucleotide exchange factor 39 {ECO:0000313|Ensembl:ENSOGAP00000006970} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=ARHGEF39 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
ARCPVQEQRARWERKRACTVRELLETEQRYQEQLGLVATYFLGILKAKGTLRPPERQALF
GSWELIYDASQQLLPYLEGGYWGPGLEGFCRHLELYTQFAANADRSQATLQEQLKKNKCF
RRFVRLQESRPEFRGLQLQDLLSLPLQRLQQYENLVVALAENTGPNSPDYKQLTRAARLI
SETAQRVHTIDQKQKNDQHLRRVQALLSGRQAKGLTSGRWFLRQGWLLVVPPHGEPRPRM
FFLFSDALLMAKPRPPLHLLQSGTFACKALYPMAQCQLHKVFGHSGGPCGGLLSLSFPHE
KLLLMSTDQEELSCWYHSLTLAI
Download sequence
Identical sequences H0WX19
ENSOGAP00000006970 ENSOGAP00000006970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]