SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WX90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WX90
Domain Number 1 Region: 207-259
Classification Level Classification E-value
Superfamily F-box domain 0.0000061
Family F-box domain 0.0093
Further Details:      
 
Domain Number 2 Region: 78-113
Classification Level Classification E-value
Superfamily MIT domain 0.0000275
Family MIT domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H0WX90
Sequence length 440
Comment (tr|H0WX90|H0WX90_OTOGA) F-box protein 9 {ECO:0000313|Ensembl:ENSOGAP00000007056} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO9 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
QAEAEEDCHSDAVRADDDEENESPAETDLQAQLQMFRAQWMFELGPSVSSGKLENQPCRA
ARGSLLKAATDTKGKQEQAKEEKARELFLKAVEEEQNGALYEAIKFYRRAMQLVPDIEFK
ITYTRSPDGDGVGNSYIEDSDDDSKMADLLSYFQQQLTFQESVLKLCQPELESGQTHISG
KLIPFDILCFALFFCISDFILILTISWLPEACKKMYALCTKDPEIWRLACLKVWGRSCIK
LVPYTSWRQMFLERPRVRFDGVYISKTTYIRQGEQSLDGFYRAWHQVEYYRYIRFFPDGS
VMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTKVFAVITKKKEEKPLDYK
YRYFRRVPVQEADQSFHVGLQLCSSGHQKFNKLIWIHHSCHITYKSTGETAVSAFEIDKM
YTPLFFARVRSYTAFSERPL
Download sequence
Identical sequences H0WX90
ENSOGAP00000007056 ENSOGAP00000007056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]