SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WXA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WXA2
Domain Number 1 Region: 152-360
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 342-477
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-31
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 452-493,531-594
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0032
Further Details:      
 
Domain Number 4 Region: 618-713
Classification Level Classification E-value
Superfamily PH domain-like 4.03e-20
Family Pleckstrin-homology domain (PH domain) 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WXA2
Sequence length 737
Comment (tr|H0WXA2|H0WXA2_OTOGA) FYVE, RhoGEF and PH domain containing 3 {ECO:0000313|Ensembl:ENSOGAP00000007069} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FGD3 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MESGGTSSTPPGLPAALGMTDAGPGSSSLGKLRALPVGPRAHCRDPGSPAAAGDSSPDTG
PVGELSSGMKIPNRDSGIDSPSSSMAGENFPSEEGSEASPGPAVLGLNPETAPHSQVLQD
TPQEEADSDVGEEPDLENSAPRADKVASLAQHSDPQKLLHIAQELLHTEETYVKRLHLLD
QVFYTRLSEAGIPPEVTTGIFSNISSIHRFHGQFLLPELQTRITEEWDMNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKEEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPGDALDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGHIQKLSAKNGTTQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNAAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGSFSPDEDPSLPPEMPMGNTSSGESAVMTEGSSATTGLEPRKLSSKIRRDKEKQSCKS
CGETFNSITKRRHHCKLCGVVICGKCSEFKAENSRQSRVCRECFLTQPVVPESPSPEASA
EPKQSTEKPPTVEPRPSLFCGPLRLLDSGEAWSEVWATIPVSDPQVLHLQGGSQDSRLPL
TIPLTNCMVSVPDPKERPDSGHVWKLQRAQQSWYLSAPSAELQQQWLEALSTATQGDMAQ
DNPGTLQLQAPVDAAAL
Download sequence
Identical sequences H0WXA2
ENSOGAP00000007069 ENSOGAP00000007069 XP_012663801.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]