SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WXX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WXX4
Domain Number 1 Region: 57-197
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000549
Family Voltage-gated potassium channels 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WXX4
Sequence length 269
Comment (tr|H0WXX4|H0WXX4_OTOGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSOGAP00000007331} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN= OC=Lorisiformes; Galagidae; Otolemur.
Sequence
LGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVS
QTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGS
DIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVT
AEFKETRRRLSVEIYDKFQRATSIKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLP
PLLKTESIYLNGLTPHCAGEEIAVIENIK
Download sequence
Identical sequences H0WXX4
ENSOGAP00000007331 ENSOGAP00000007331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]