SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WYD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WYD5
Domain Number 1 Region: 112-172,292-375
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.75e-33
Family Regulator of G-protein signaling, RGS 0.0076
Further Details:      
 
Domain Number 2 Region: 370-509
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.12e-28
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WYD5
Sequence length 661
Comment (tr|H0WYD5|H0WYD5_OTOGA) A-kinase anchoring protein 10 {ECO:0000313|Ensembl:ENSOGAP00000007517} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=AKAP10 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDGKSIRASVSVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLHDTVVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHTLNTVKQS
SLAEPVSPSKKHESTASFVTESLDKRLEDSSSAQLLMTQSEGIDLNNRTNSTQNHLLLSQ
ECGSAHSLHLQMARAGTHQVSMETQESSRFIVANRNNPSSPLKDLSGKLMKSIEQDAVNT
FTKYISPDAAKPIPITEAMRNDIIAKICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLR
SHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAA
KKGQYDGQEAQSDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPLR
QAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNISLAAHGSVGPPDEANAGGS
DSSTSQSSVKKASIKILKNFDEVIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRES
EPEPDVKKSKGSMFSQAMKKWVQGSTDEAQEELAWKIAKMIVSDVMQQAQCDQPVERSTK
L
Download sequence
Identical sequences H0WYD5
ENSOGAP00000007517 XP_003791112.1.62490 ENSOGAP00000007517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]