SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WYS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WYS0
Domain Number 1 Region: 14-130
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-28
Family Kringle modules 0.00083
Further Details:      
 
Domain Number 2 Region: 217-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WYS0
Sequence length 461
Comment (tr|H0WYS0|H0WYS0_OTOGA) Kringle containing transmembrane protein 2 {ECO:0000313|Ensembl:ENSOGAP00000007683} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KREMEN2 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MGTRVLQGFLLLFFPLLQPHEASAESLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCL
FWNQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGTESDLA
RGRLALATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVVYSPDFPDEYGP
DRNCSWALGPPGAALELTFRLFELADQRDRLELRDATSGHLLRAFDGARPPPPGPLRLRA
AALLITFRSDSRGHAQGFALTYRGLPESIEDPASHKDSAQTTNAPPDGANVSCSPRPRAP
PVAMGAPVFSTVMSVSVLLLLFLSLLRLLRRRSCLLAPGKGAPALGPSEGPGKRWAVWYR
RPQEVALPCPPGDSQAEGPAPSYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences H0WYS0
XP_003790858.1.62490 ENSOGAP00000007683 ENSOGAP00000007683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]