SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WYV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WYV8
Domain Number 1 Region: 477-767
Classification Level Classification E-value
Superfamily Folate-binding domain 4.08e-84
Family Aminomethyltransferase folate-binding domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 52-265,376-440
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-57
Family FAD-linked reductases, N-terminal domain 0.00043
Further Details:      
 
Domain Number 3 Region: 265-375
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.77e-28
Family L-aminoacid/polyamine oxidase 0.0077
Further Details:      
 
Domain Number 4 Region: 769-854
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 4.41e-22
Family Aminomethyltransferase beta-barrel domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WYV8
Sequence length 876
Comment (tr|H0WYV8|H0WYV8_OTOGA) Dimethylglycine dehydrogenase {ECO:0000313|Ensembl:ENSOGAP00000007731} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=DMGDH OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MLRPAAQRLRGLALRSCPLRGSPGRPRSVCGREGDEKSLLPAEAKWKDRAETVIIGGGCI
GVSLAYHLAKAGMKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLE
EETGQVVGFHQPGSIRLATTPVRVDEFKYQMTRTGWHATEQYIIEPEKIQEMFPLLNMNK
VLAGLYNPGDGHIDPYSLTMALAVGARKYGALLKYPAPVTSLKLRSDGTWDVETPQGSLR
ANRIVNAAGFWAREVGKMVGLEHPLIPVQHQYVITSTIPEVKALKRELPVIRDLEGSYYL
RQERDGLLFGPYESQEKMKAQDSWVTSGVPPGFGKELFESDLDRIMEHVEIAMEMVPVLK
KADIINIVNGPITYSPDILPMVGPHQGVRNYWVAIGFGYGIIHAGGVGKYLSEWILHGEP
PFDLIELDPNRYGKWTTTQYTEVKARESYGFNNIVGYPKEERFAGRPTQRVSGLYKILES
KCSMGFHAGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGCEYKQVMQRVGVIDLSPFGKF
NIKGRDSIRLLDRLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSE
LHDLRWIEEEAVNGGYDVEIKNITDELGVLGVAGPRARKVLQKLTSEDLSDDAFKFLQTK
SFKVSNIPVTAIRISYTGELGWELYHRQEDSAALYDVIMNAGQEEEIDNFGTYAMNALRL
EKAFRAWGSEMNCDTNPLEAGLESFVKLNKPADFIGKQALRQIKAKGLKRRLVFLTLATD
DVDPEGNESVWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVELSEVGQQVEVELLGKTYPA
VITREPLVLTEPARNRLQKKGGKDKWFPGYSRNPRF
Download sequence
Identical sequences H0WYV8
ENSOGAP00000007731 ENSOGAP00000007731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]