SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WZH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WZH2
Domain Number 1 Region: 90-170
Classification Level Classification E-value
Superfamily F-box domain 1.44e-17
Family F-box domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WZH2
Sequence length 187
Comment (tr|H0WZH2|H0WZH2_OTOGA) F-box protein 36 {ECO:0000313|Ensembl:ENSOGAP00000007991} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=FBXO36 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MASWLPETLFEIVGQGPAPSKDYYQILVKRSQVIFRWWKISLRSEHRSAQPGEVKETHED
FLENSHLQVQIALIFGERVLDYIFNLCEGKFDFLERLSDNLLLSIISYLDLEDIARLSQT
SRRFAKLCMCEKLWEQIVKSSCDTITPDMQALAEDMGWRKMFFTNKLQLQQQLCKGKQNH
GNHIEKE
Download sequence
Identical sequences H0WZH2
ENSOGAP00000007991 ENSOGAP00000007991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]