SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WZM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WZM1
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-28
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-25
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H0WZM1
Sequence length 492
Comment (tr|H0WZM1|H0WZM1_OTOGA) Kringle containing transmembrane protein 1 {ECO:0000313|Ensembl:ENSOGAP00000008049} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=KREMEN1 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
XAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFW
NETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
NLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNADYWKY
GEAASTECNSVCFGDHTQPCGGDGRIILFDTLVGACGGNYSAMTSVVYSPDFPDTYATGR
VCYWTIRVPGASRIHFSFPLFDIRDSADMVELLDGYTHRVLARFHGRSRPPLSFNVSLDF
VILYFFSDRVNQAQGFAVLYQAIKEEPPQERPTVNQTLAEVITEQTNLSVSAARSSKVLY
VITTSPSQPTQTVPGSNSWTPSVGAKSRRVEGWTVYGLATLLILTVTAIVAKILLHVTFK
SHRVPASGDIRDCHQPGTSGEIWSIFYKPSTSISIFKKKLKSQSQQDDRNPLVIQGSAAM
SLTCSQGQHRGI
Download sequence
Identical sequences H0WZM1
ENSOGAP00000008049 ENSOGAP00000008049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]