SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H0WZP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H0WZP0
Domain Number 1 Region: 102-427
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.17e-46
Family Gamma-glutamyltranspeptidase-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H0WZP0
Sequence length 495
Comment (tr|H0WZP0|H0WZP0_OTOGA) Gamma-glutamyltransferase 6 {ECO:0000313|Ensembl:ENSOGAP00000008070} KW=Complete proteome; Reference proteome OX=30611 OS=Otolemur garnettii (Small-eared galago) (Garnett's greater bushbaby). GN=GGT6 OC=Lorisiformes; Galagidae; Otolemur.
Sequence
MDPTEGPVLYQKLLLWESSLEVEEEEEEEEEREISQPLVPNPWRPQDSSGNKPSGLPGAW
ARLAASLLLLAISGSLAVWQLQTKGGLTGNLGSVAPPPSGHSHSPGVYHHSAIISPAATC
SDLGRELLVAGGNVVDAGVGAALCLAVVHPHATGLGATFWGLFHNSSSGNSTALTSGPAQ
TLASNLALPAALPTLHLIHARFGRLPWPRLLVGPIALAQKGFLVDTALAKALAAQGTEGL
CPLLCHADGTPLGPGARATNPKLAAVLQGAALTPTSDLAGDALLSLLARDLGVEAPSAGP
RPTLEPAMRLPMPQGILFTTPSPSAGPELLAQLETTLVSGAPSPDPCPPFLQTTTTPASS
ILATVDNSGSMLLLISSLNSSFGSGHLSPSTGVLLSNLVPGSATSTWACPLILHGSPDDT
EAEVFGWVASGTPDVARAIACALVSHLAGPQSQTQQEPTESPKACGQGTLLQVSAHAEHA
HVSSVPSGCCPFQGF
Download sequence
Identical sequences H0WZP0
XP_003799090.1.62490 ENSOGAP00000008070 ENSOGAP00000008070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]